PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c4_12510V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 504aa    MW: 55182.3 Da    PI: 8.4762
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c4_12510V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161360148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W +eEde+l ++v+ +G+g+W+++ ++ g++R++k+c++rw +yl
  Pp3c4_12510V3.1.p 13 KGAWAAEEDEKLRKYVETYGTGHWRSVGKKAGLRRCGKSCRLRWTNYL 60
                       799*******************************************97 PP

2Myb_DNA-binding56.28.2e-1867109246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        g++T++E++l+v++++ +G++ W++Ia+ m+ gRt++++k++w++
  Pp3c4_12510V3.1.p  67 GSFTPQEEDLIVKLHAAHGSR-WSLIAAQMP-GRTDNDIKNHWNT 109
                        78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.203860IPR017930Myb domain
SuperFamilySSF466891.09E-2911107IPR009057Homeodomain-like
SMARTSM007179.1E-141262IPR001005SANT/Myb domain
PfamPF002497.2E-151360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-231467IPR009057Homeodomain-like
CDDcd001676.20E-111560No hitNo description
PROSITE profilePS5129427.0461115IPR017930Myb domain
SMARTSM007175.5E-1665113IPR001005SANT/Myb domain
PfamPF002493.1E-1667109IPR001005SANT/Myb domain
CDDcd001674.11E-1268111No hitNo description
Gene3DG3DSA:1.10.10.607.9E-2668115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MTRLSKASED VRKGAWAAEE DEKLRKYVET YGTGHWRSVG KKAGLRRCGK SCRLRWTNYL  60
RPDIRHGSFT PQEEDLIVKL HAAHGSRWSL IAAQMPGRTD NDIKNHWNTR LKKKLCDMGI  120
DPVTHKPIAD LLRDLAGTMG QSSGGINQIA EEAARRCFRD NLVSKAVREC GKNVNSAPTV  180
SQFMNQALNV QHTEEVMSIH LELHGGGDHM GQKSSNNSGN SHSMDESSST DEAPSRRSLS  240
PPISTNFDQR RGATGTVVES SCGQIAYLSS TQMQNEANLQ ARFTEGGATP TGSFHDPTPG  300
CTSVTTTSLQ SAGADVFYQR KRDPTLVGSG KPFQTRTEYN RWLSSRSAPP QEDFLNSVVQ  360
LPLSRFGSEV QNQMAVPNHA EVSYMQGSDV TRSQSTSAAS KLDIRINLGF NQQPASLQES  420
LNFGYRNFSS PLMSSNSTGN SLLDTNTQHA LSGYAGQFSS SIITPSNVNM ASFNSPLAGA  480
TAGLRLHEYE VPSPRMVLWD FQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27101154108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S284_57V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.13e-60myb domain protein 103